Quick search:







Description Entry page for GPCR - 'HISTAMINE RECEPTORS_H3_Homo sapiens'
ClassCLASS A
FamilyHISTAMINE RECEPTORS
Sub-FamilyH3
Cross References:
References
UniProtQ9Y5N1 | Q4QRI7 | Q9GZX2 | Q9H4K8
EMBLAF140538 | AB045369 | AB019000 | AJ296652 | AJ278250 | AF363791 | AL078633 | BC096840
InterProIPR000276 | IPR017452 | IPR003980
PRODOM
GENEID11255
MIM604525
PRINTSPR00237 | PR01471
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameHISTAMINE RECEPTORS_H3_Homo sapiens
DescriptionRecName: Full=Histamine H3 receptor; Short=HH3R;AltName: Full=G-protein coupled receptor 97
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHRH3 | GPCR9
FunctionThe H3 subclass of histamine receptors could mediate thes histamine signals in CNS and peripheral nervous system
Fragment0
Sequence
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o10347254
2Galpha-i3_Homo sapiensGi/o10347254
3Galpha-o_Homo sapiensGi/o10347254
4Galpha-z_Homo sapiensGi/o10347254
5Galpha-i1_Homo sapiensGi/o10347254
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level