Quick search:







Description Entry page for GPCR - 'HISTAMINE RECEPTORS_H4_Homo sapiens'
ClassCLASS A
FamilyHISTAMINE RECEPTORS
Sub-FamilyH4
Cross References:
References
UniProtQ9H3N8 | Q4G0I6 | Q9GZQ0
EMBLAB044934 | AB045370 | AF307973 | AF312230 | AF329449 | AF325356 | AJ298292 | AY136745 | BC069136 | BC112348
InterProIPR000276 | IPR017452 | IPR008102
PRODOM
GENEID59340
MIM606792
PRINTSPR00237 | PR01726
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameHISTAMINE RECEPTORS_H4_Homo sapiens
DescriptionRecName: Full=Histamine H4 receptor; Short=HH4R;AltName: Full=G-protein coupled receptor 105;AltName: Full=GPRv53;AltName: Full=SP9144;AltName: Full=AXOR35;AltName: Full=Pfi-013
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHRH4 | GPCR10
FunctionThe H4 subclass of histamine receptors could mediate thes histamine signals in peripheral tissues
Fragment0
Sequence
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o10973974
2Galpha-i1_Homo sapiensGi/o10973974
3Galpha-z_Homo sapiensGi/o10973974
4Galpha-o_Homo sapiensGi/o10973974
5Galpha-i3_Homo sapiensGi/o10973974
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level