Quick search:







Description Entry page for GPCR - 'KiSS1-DERIVED PEPTIDE RECEPTORS_KiSS1 receptor_Homo sapiens'
ClassCLASS A
FamilyKiSS1-DERIVED PEPTIDE RECEPTORS
Sub-FamilyKiSS1 receptor
Cross References:
References
UniProtQ969F8 | Q96QG0
EMBLAB051065 | AF343725 | AJ309020 | AY029541 | AY253981 | AY253982 | AC005379
InterProIPR000276 | IPR017452 | IPR008103
PRODOM
GENEID84634
MIM146110 | 176400 | 604161
PRINTSPR00237 | PR01728
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameKiSS1-DERIVED PEPTIDE RECEPTORS_KiSS1 receptor_Homo sapiens
DescriptionRecName: Full=KiSS-1 receptor; Short=KiSS-1R;AltName: Full=Kisspeptins receptor;AltName: Full=Metastin receptor;AltName: Full=G-protein coupled receptor 54;AltName: Full=Hypogonadotropin-1; Short=hOT7T175
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKISS1R | AXOR12,GPR54,OT7T17
FunctionReceptor for metastin (kisspeptin-54 or kp-54), a C-s terminally amidated peptide of KiSS1
Fragment0
Sequence
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN
SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY
IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL
HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP
ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA
AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH
AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-11_Homo sapiensGq/1115932928
2Galpha-14_Homo sapiensGq/1115932928
3Galpha-15_Homo sapiensGq/1115932928
4Galpha-q_Homo sapiensGq/1115932928
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level