Quick search:







Description Entry page for GPCR - 'LEUKOTRIENE RECEPTORS_CYSLT1_Homo sapiens'
ClassCLASS A
FamilyLEUKOTRIENE RECEPTORS
Sub-FamilyCYSLT1
Cross References:
References
UniProtQ9Y271 | B2R954 | Q5JS94 | Q8IV19
EMBLAF119711 | AF133266 | AY242130 | AK313643 | AL445202 | CH471104 | BC035750
InterProIPR000276 | IPR013310 | IPR004071 | IPR017452
PRODOM
GENEID10800
MIM300201
PRINTSPR01902 | PR01533 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLEUKOTRIENE RECEPTORS_CYSLT1_Homo sapiens
DescriptionRecName: Full=Cysteinyl leukotriene receptor 1; Short=CysLTR1;AltName: Full=Cysteinyl leukotriene D4 receptor; Short=LTD4 receptor;AltName: Full=HG55;AltName: Full=HMTMF81
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCYSLTR1 | CYSLT
FunctionReceptor for cysteinyl leukotrienes mediatings bronchoconstriction of individuals with and without asthma
Fragment0
Sequence
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/1110391245
2Galpha-q_Homo sapiensGq/1110391245
3Galpha-14_Homo sapiensGq/1110391245
4Galpha-11_Homo sapiensGq/1110391245
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level