Quick search:







Description Entry page for GPCR - 'LEUKOTRIENE RECEPTORS_CYSLT2_Homo sapiens'
ClassCLASS A
FamilyLEUKOTRIENE RECEPTORS
Sub-FamilyCYSLT2
Cross References:
References
UniProtQ9NS75 | Q9HCQ2
EMBLAB038269 | AF254664 | AF279611 | AB083603 | AY389504 | AL137118 | BC069160 | AB041644
InterProIPR000276 | IPR013311 | IPR004071 | IPR017452
PRODOM
GENEID57105
MIM605666
PRINTSPR01903 | PR01533 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLEUKOTRIENE RECEPTORS_CYSLT2_Homo sapiens
DescriptionRecName: Full=Cysteinyl leukotriene receptor 2; Short=CysLTR2;AltName: Full=HG57;AltName: Full=HPN321;AltName: Full=hGPCR21
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCYSLTR2 | CYSLT2,CYSLT2R | PSEC014
FunctionReceptor for cysteinyl leukotrienes
Fragment0
Sequence
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-11_Homo sapiensGq/1110913337
2Galpha-14_Homo sapiensGq/1110913337
3Galpha-15_Homo sapiensGq/1110913337
4Galpha-q_Homo sapiensGq/1110913337
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level