Quick search:







Description Entry page for GPCR - 'LEUKOTRIENE RECEPTORS_CYSLT1_Homo sapiens'
ClassCLASS A
FamilyLEUKOTRIENE RECEPTORS
Sub-FamilyCYSLT1
Cross References:
References
UniProtQ13304 | A8K9L0 | B2R9X0 | Q8N5S7 | Q9UDZ6 | Q9UE21
EMBLU33447 | Y12546 | Z94154 | Z94155 | AK292725 | AK313949 | CH471103 | BC031653 | BC039595
InterProIPR000276 | IPR017452 | IPR002286
PRODOM
GENEID2840
MIM603071
PRINTSPR00237 | PR01157
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLEUKOTRIENE RECEPTORS_CYSLT1_Homo sapiens
DescriptionRecName: Full=Uracil nucleotide/cysteinyl leukotriene receptor;AltName: Full=UDP/CysLT receptor;AltName: Full=G-protein coupled receptor 17;AltName: Full=P2Y-like receptor;AltName: Full=R12
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPR1
FunctionDual specificity receptor for uracil nucleotides ands cysteinyl leukotrienes (CysLTs)
Fragment0
Sequence
MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENM
LFASFYLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHF
SGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLAC
AFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCY
LLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQ
RILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESS
LSAKSEL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-q_Homo sapiensGq/1110391245
2Galpha-15_Homo sapiensGq/1110391245
3Galpha-11_Homo sapiensGq/1110391245
4Galpha-14_Homo sapiensGq/1110391245
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level