Quick search:







Description Entry page for GPCR - 'LEUKOTRIENE RECEPTORS_BLT1_Homo sapiens'
ClassCLASS A
FamilyLEUKOTRIENE RECEPTORS
Sub-FamilyBLT1
Cross References:
References
UniProtQ15722 | Q13305 | Q92641 | Q9BSU5
EMBLU41070 | U33448 | D89079 | D89078 | X98356 | AB008193 | AY322535 | BC004545
InterProIPR000276 | IPR017452 | IPR003981 | IPR003983
PRODOM
GENEID1241
MIM601531
PRINTSPR00237 | PR01477 | PR01476
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLEUKOTRIENE RECEPTORS_BLT1_Homo sapiens
DescriptionRecName: Full=Leukotriene B4 receptor 1; Short=LTB4-R 1;AltName: Full=P2Y purinoceptor 7; Short=P2Y7;AltName: Full=Chemoattractant receptor-like 1;AltName: Full=G-protein coupled receptor 16
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneLTB4R | BLT,BLT1,BLTR,CMKRL1,GPR16,P2RY
FunctionReceptor for extracellular ATP > UTP and ADP
Fragment0
Sequence
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-14_Homo sapiensGq/119177352
2Galpha-i3_Homo sapiensGi/o9177352
3Galpha-i1_Homo sapiensGi/o9177352
4Galpha-11_Homo sapiensGq/119177352
5Galpha-i2_Homo sapiensGi/o9177352
6Galpha-z_Homo sapiensGi/o9177352
7Galpha-o_Homo sapiensGi/o9177352
8Galpha-15_Homo sapiensGq/119177352
9Galpha-q_Homo sapiensGq/119177352
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level