Quick search:







Description Entry page for GPCR - 'LEUKOTRIENE RECEPTORS_BLT2_Homo sapiens'
ClassCLASS A
FamilyLEUKOTRIENE RECEPTORS
Sub-FamilyBLT2
Cross References:
References
UniProtQ9NPC1 | Q9NPE5
EMBLAF277230 | AB029892 | AB008193 | AJ278605 | AY268433 | AF308571 | AB044402 | AB083604
InterProIPR000276 | IPR017452 | IPR003981 | IPR003982
PRODOM
GENEID56413
MIM605773
PRINTSPR00237 | PR01478 | PR01476
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLEUKOTRIENE RECEPTORS_BLT2_Homo sapiens
DescriptionRecName: Full=Leukotriene B4 receptor 2; Short=LTB4-R2;AltName: Full=Seven transmembrane receptor BLTR2;AltName: Full=Leukotriene B4 receptor BLT2;AltName: Full=LTB4 receptor JULF2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneLTB4R2 | BLT2R,BLTR
FunctionLow-affinity receptor for leukotrienes includings leukotriene B4
Fragment0
Sequence
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL
AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL
GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA
LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR
GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA
RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT
TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o9177352
2Galpha-11_Homo sapiensGq/119177352
3Galpha-i3_Homo sapiensGi/o9177352
4Galpha-q_Homo sapiensGq/119177352
5Galpha-o_Homo sapiensGi/o9177352
6Galpha-i1_Homo sapiensGi/o9177352
7Galpha-i2_Homo sapiensGi/o9177352
8Galpha-14_Homo sapiensGq/119177352
9Galpha-15_Homo sapiensGq/119177352
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level