Quick search:







Description Entry page for GPCR - 'LEUKOTRIENE RECEPTORS_Oxoecosanoid_Homo sapiens'
ClassCLASS A
FamilyLEUKOTRIENE RECEPTORS
Sub-FamilyOxoecosanoid
Cross References:
References
UniProtQ8TDS5 | Q86WP7 | Q8NGW4
EMBLAB083055 | AY158687 | AB065652 | AB083630 | AC098824 | BC063549
InterProIPR000276 | IPR017452
PRODOM
GENEID165140
MIM
PRINTSPR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLEUKOTRIENE RECEPTORS_Oxoecosanoid_Homo sapiens
DescriptionRecName: Full=Oxoeicosanoid receptor 1;AltName: Full=5-oxo-ETE G-protein coupled receptor;AltName: Full=G-protein coupled receptor TG1019;AltName: Full=G-protein coupled receptor 170;AltName: Full=G-protein coupled receptor R527
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneOXER1 | GPR170,TG101
FunctionReceptor for eicosanoids and polyunsaturated fatty acidss such as 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid (5-OXO-ETE),s 5(S)-hydroperoxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HPETE)s and arachidonic acid
Fragment0
Sequence
MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPS
FSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIH
TRPWTSNTVFLVSLVAADFLLISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASV
VFLTAIALNRYLKVVQPHHVLSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSY
RVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV
VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVLDPVLYCFSSP
NFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS
SQG
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o12606753 | 12065583
2Galpha-i1_Homo sapiensGi/o12606753 | 12065583
3Galpha-o_Homo sapiensGi/o12606753 | 12065583
4Galpha-z_Homo sapiensGi/o12606753 | 12065583
5Galpha-i3_Homo sapiensGi/o12606753 | 12065583
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level