Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_LPA6_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilySpingosine like
Cross References:
References
UniProtP46095 | Q17RJ7 | Q5SYL0
EMBLL36150 | U18549 | AL591076 | BC043414 | BC117298 | BC126301
InterProIPR000276 | IPR017452 | IPR001151 | IPR000723
PRODOM
GENEID2830
MIM600553
PRINTSPR00237 | PR00649 | PR00644
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_LPA6_Homo sapiens
DescriptionRecName: Full=G-protein coupled receptor 6;AltName: Full=Sphingosine 1-phosphate receptor GPR6
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPR
FunctionOrphan receptor with constitutive G(s) signalings activity that activate cyclic AMP
Fragment0
Sequence
MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQL
SAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLL
AGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRR
TLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGI
MLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCV
VGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPS
EV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o12069813
2Galpha-i1_Homo sapiensGi/o12069813
3Galpha-i2_Homo sapiensGi/o12069813
4Galpha-i3_Homo sapiensGi/o12069813
5Galpha-z_Homo sapiensGi/o12069813
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level