Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_LPA1_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyLPA1
Cross References:
References
UniProtQ92633 | O00656 | O00722 | P78351
EMBLU80811 | Y09479 | Y09479 | U78192 | AY322546 | BC030615 | BC036034
InterProIPR000276 | IPR017452 | IPR004065 | IPR002277
PRODOM
GENEID1902
MIM602282
PRINTSPR01148 | PR00237 | PR01527
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_LPA1_Homo sapiens
DescriptionRecName: Full=Lysophosphatidic acid receptor 1; Short=LPA receptor 1; Short=LPA-1;AltName: Full=Lysophosphatidic acid receptor Edg-2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneLPAR1 | EDG2,LPA
FunctionReceptor for lysophosphatidic acid (LPA), a mediator ofs diverse cellular activities
Fragment0
Sequence
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o9070858
2Galpha-i3_Homo sapiensGi/o9070858
3Galpha-15_Homo sapiensGq/1112069813
4Galpha-q_Homo sapiensGq/1112069813
5Galpha-i2_Homo sapiensGi/o9070858
6Galpha-11_Homo sapiensGq/1112069813
7Galpha-13_Homo sapiensG12/1312069813
8Galpha-o_Homo sapiensGi/o9070858
9Galpha-12_Homo sapiensG12/1312069813
10Galpha-14_Homo sapiensGq/1112069813
11Galpha-i1_Homo sapiensGi/o9070858
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level