Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_LPA2_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyLPA2
Cross References:
References
UniProtQ9HBW0 | O00543 | O43431
EMBLAF011466 | AF233092 | AF197929 | AY322548 | AC002306 | BC025695
InterProIPR000276 | IPR017452 | IPR004065 | IPR004066
PRODOM
GENEID9170
MIM605110
PRINTSPR01528 | PR00237 | PR01527
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_LPA2_Homo sapiens
DescriptionRecName: Full=Lysophosphatidic acid receptor 2; Short=LPA receptor 2; Short=LPA-2;AltName: Full=Lysophosphatidic acid receptor Edg-4
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneLPAR2 | EDG4,LPA
FunctionReceptor for lysophosphatidic acid (LPA), a mediator ofs diverse cellular activities
Fragment0
Sequence
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o9525886
2Galpha-12_Homo sapiensG12/1312215548
3Galpha-i1_Homo sapiensGi/o9525886
4Galpha-11_Homo sapiensGq/119525886
5Galpha-o_Homo sapiensGi/o9525886
6Galpha-q_Homo sapiensGq/119525886
7Galpha-i2_Homo sapiensGi/o9525886
8Galpha-14_Homo sapiensGq/119525886
9Galpha-13_Homo sapiensG12/1312215548
10Galpha-15_Homo sapiensGq/119525886
11Galpha-z_Homo sapiensGi/o9525886
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level