Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_LPA3_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyLPA3
Cross References:
References
UniProtQ9UBY5 | A0AVA3
EMBLAF127138 | AF186380 | AY322547 | BC126268 | BC126270
InterProIPR000276 | IPR017452 | IPR004065 | IPR005385
PRODOM
GENEID23566
MIM605106
PRINTSPR01560 | PR00237 | PR01527
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_LPA3_Homo sapiens
DescriptionRecName: Full=Lysophosphatidic acid receptor 3; Short=LPA receptor 3; Short=LPA-3;AltName: Full=Lysophosphatidic acid receptor Edg-7
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneLPAR3 | EDG7,LPA
FunctionReceptor for lysophosphatidic acid (LPA), a mediator ofs diverse cellular activities
Fragment0
Sequence
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/1112215548
2Galpha-o_Homo sapiensGi/o12215548
3Galpha-z_Homo sapiensGi/o12215548
4Galpha-q_Homo sapiensGq/1112215548
5Galpha-i2_Homo sapiensGi/o12215548
6Galpha-i1_Homo sapiensGi/o12215548
7Galpha-12_Homo sapiensG12/1312215548
8Galpha-11_Homo sapiensGq/1112215548
9Galpha-14_Homo sapiensGq/1112215548
10Galpha-i3_Homo sapiensGi/o12215548
11Galpha-13_Homo sapiensG12/1312215548
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level