Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_LPA4_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyLPA4
Cross References:
References
UniProtQ99677 | B2RAC7 | O15132 | Q502U9 | Q6NSP5
EMBLU66578 | U90323 | U90322 | AF005419 | AY301274 | AK314134 | AL590083 | CH471104 | BC069996 | BC074722 | BC095538
InterProIPR000276 | IPR017452 | IPR002188
PRODOM
GENEID2846
MIM300086
PRINTSPR00237 | PR01067
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_LPA4_Homo sapiens
DescriptionRecName: Full=Lysophosphatidic acid receptor 4; Short=LPA receptor 4; Short=LPA-4;AltName: Full=P2Y purinoceptor 9; Short=P2Y9;AltName: Full=Purinergic receptor 9;AltName: Full=G-protein coupled receptor 23;AltName: Full=P2Y5-like receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneLPAR4 | GPR23,LPA4,P2RY
FunctionReceptor for lysophosphatidic acid (LPA), a mediator ofs diverse cellular activities
Fragment0
Sequence
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS
LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN
GGELMLESTF
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_2Gs12724320
2Galpha-14_Homo sapiensGq/1112724320
3Galpha-11_Homo sapiensGq/1112724320
4Galpha-q_Homo sapiensGq/1112724320
5Galpha-s_Homo sapiens_1Gs12724320
6Galpha-15_Homo sapiensGq/1112724320
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level