Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_Sphingosylphosphorylcholine_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilySphingosylphosphorylcholine
Cross References:
References
UniProtQ15743 | Q13334 | Q4VBB4 | Q6IX34
EMBLU35398 | U48405 | EU883575 | AY615372 | AL135818 | CH471061 | BC067472 | BC069592 | BC096071 | BC096072 | BC096073 | BC096074 | BC098567
InterProIPR000276 | IPR017452 | IPR005389
PRODOM
GENEID8111
MIM601404
PRINTSPR00237 | PR01564
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_Sphingosylphosphorylcholine_Homo sapiens
DescriptionRecName: Full=Ovarian cancer G-protein coupled receptor 1; Short=OGR-1;AltName: Full=G-protein coupled receptor 68;AltName: Full=Sphingosylphosphorylcholine receptor;AltName: Full=GPR12A
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPR68 | OGR
FunctionProton-sensing receptor involved in pH homeostasis
Fragment0
Sequence
MGNITADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYL
CNLTVADLFYICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRY
LAVAHPFRFHQFRTLKAAVGVSVVIWAKELLTSIYFLMHEEVIEDENQHRVCFEHYPIQA
WQRAINYYRFLVGFLFPICLLLASYQGILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLAC
FLPYHVLLLVRSVWEASCDFAKGVFNAYHFSLLLTSFNCVADPVLYCFVSETTHRDLARL
RGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFP
TGRLA
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o12069813
2Galpha-o_Homo sapiensGi/o12069813
3Galpha-i1_Homo sapiensGi/o12069813
4Galpha-i3_Homo sapiensGi/o12069813
5Galpha-z_Homo sapiensGi/o12069813
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level