Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_Spingosine like_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyLPA6
Cross References:
References
UniProtP43657 | A4FTW9 | B3KVF2 | O15133 | Q3KPF5 | Q53FA0 | Q5VW44 | Q7Z3S0
EMBLL11910 | L78805 | AF000546 | BX537392 | BX537438 | BX537445 | AK122856 | AK223389 | AF551763 | AL392048 | CH471075 | BC040850 | BC045651 | BC070295 | BC106756
InterProIPR000276 | IPR017452 | IPR002188
PRODOM
GENEID10161
MIM278150 | 609239 | 611452
PRINTSPR00237 | PR01067
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_Spingosine like_Homo sapiens
DescriptionRecName: Full=Oleoyl-L-alpha-lysophosphatidic acid receptor;AltName: Full=P2Y purinoceptor 5; Short=P2Y5;AltName: Full=Purinergic receptor 5;AltName: Full=RB intron encoded G-protein coupled receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneP2RY
FunctionBinds to oleoyl-L-alpha-lysophosphatidic acid (LPA)
Fragment0
Sequence
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF
CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs19386608
2Galpha-12_Homo sapiensG12/1319386608
3Galpha-13_Homo sapiensG12/1319386608
4Galpha-s_Homo sapiens_2Gs19386608
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level