Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_S1P1_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyS1P1
Cross References:
References
UniProtP21453 | Q9BYY4 | Q9NYN8
EMBLM31210 | AF022137 | AF233365 | AK312493 | CR541786 | CR542269 | AL109741 | CH471097 | BC018650
InterProIPR000276 | IPR000987 | IPR004061
PRODOM
GENEID1901
MIM601974
PRINTSPR00642 | PR00237 | PR01523
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_S1P1_Homo sapiens
DescriptionRecName: Full=Sphingosine 1-phosphate receptor 1; Short=S1P receptor 1; Short=S1P1;AltName: Full=Sphingosine 1-phosphate receptor Edg-1; Short=S1P receptor Edg-1;AltName: Full=Endothelial differentiation G-protein coupled receptor 1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneS1PR1 | CHEDG1,EDG
FunctionReceptor for the lysosphingolipid sphingosine 1-s phosphate (S1P)
Fragment0
Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o9488656
2Galpha-i2_Homo sapiensGi/o9488656
3Galpha-o_Homo sapiensGi/o9488656
4Galpha-i3_Homo sapiensGi/o9488656
5Galpha-i1_Homo sapiensGi/o9488656
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level