Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_S1P2_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyS1P2
Cross References:
References
UniProtO95136 | Q86UN8
EMBLAF034780 | AY262688 | BC069598
InterProIPR000276 | IPR004063 | IPR017452 | IPR004061
PRODOM
GENEID9294
MIM605111
PRINTSPR01525 | PR00237 | PR01523
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_S1P2_Homo sapiens
DescriptionRecName: Full=Sphingosine 1-phosphate receptor 2; Short=S1P receptor 2; Short=S1P2;AltName: Full=Sphingosine 1-phosphate receptor Edg-5; Short=S1P receptor Edg-5;AltName: Full=Endothelial differentiation G-protein coupled receptor 5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneS1PR2 | EDG
FunctionReceptor for the lysosphingolipid sphingosine 1-s phosphate (S1P)
Fragment0
Sequence
MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o10488065
2Galpha-i2_Homo sapiensGi/o10488065
3Galpha-12_Homo sapiensG12/1310488065
4Galpha-11_Homo sapiensGq/1110617617
5Galpha-z_Homo sapiensGi/o10488065
6Galpha-14_Homo sapiensGq/1110617617
7Galpha-13_Homo sapiensG12/1310488065
8Galpha-15_Homo sapiensGq/1110617617
9Galpha-q_Homo sapiensGq/1110617617
10Galpha-i1_Homo sapiensGi/o10488065
11Galpha-o_Homo sapiensGi/o10488065
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level