Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_S1P3_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyS1P3
Cross References:
References
UniProtQ99500 | Q5SQD8 | Q7Z5I2
EMBLX83864 | AF022139 | AY322540 | AK312798 | AL772202 | CH471089 | BC060827 | BC069579
InterProIPR000276 | IPR004062 | IPR017452 | IPR004061
PRODOM
GENEID1903
MIM601965
PRINTSPR01524 | PR00237 | PR01523
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_S1P3_Homo sapiens
DescriptionRecName: Full=Sphingosine 1-phosphate receptor 3; Short=S1P receptor 3; Short=S1P3;AltName: Full=Sphingosine 1-phosphate receptor Edg-3; Short=S1P receptor Edg-3;AltName: Full=Endothelial differentiation G-protein coupled receptor 3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneS1PR3 | EDG
FunctionReceptor for the lysosphingolipid sphingosine 1-s phosphate (S1P)
Fragment0
Sequence
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-11_Homo sapiensGq/119409733
2Galpha-i3_Homo sapiensGi/o9409733
3Galpha-z_Homo sapiensGi/o9409733
4Galpha-i1_Homo sapiensGi/o9409733
5Galpha-i2_Homo sapiensGi/o9409733
6Galpha-15_Homo sapiensGq/119409733
7Galpha-q_Homo sapiensGq/119409733
8Galpha-13_Homo sapiensG12/1310488065
9Galpha-12_Homo sapiensG12/1310488065
10Galpha-14_Homo sapiensGq/119409733
11Galpha-o_Homo sapiensGi/o9409733
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level