Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_S1P4_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyS1P4
Cross References:
References
UniProtO95977
EMBLAJ000479 | AY322537 | BC014970
InterProIPR000276 | IPR004064 | IPR017452 | IPR004061
PRODOM
GENEID8698
MIM603751
PRINTSPR01526 | PR00237 | PR01523
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_S1P4_Homo sapiens
DescriptionRecName: Full=Sphingosine 1-phosphate receptor 4; Short=S1P receptor 4; Short=S1P4;AltName: Full=Sphingosine 1-phosphate receptor Edg-6; Short=S1P receptor Edg-6;AltName: Full=Endothelial differentiation G-protein coupled receptor 6
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneS1PR4 | EDG
FunctionReceptor for the lysosphingolipid sphingosine 1-s phosphate (S1P)
Fragment0
Sequence
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/1110679247
2Galpha-11_Homo sapiensGq/1110679247
3Galpha-14_Homo sapiensGq/1110679247
4Galpha-q_Homo sapiensGq/1110679247
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level