Quick search:







Description Entry page for GPCR - 'LYSOPHOSPHOLIPID RECEPTORS_S1P5_Homo sapiens'
ClassCLASS A
FamilyLYSOPHOSPHOLIPID RECEPTORS
Sub-FamilyS1P5
Cross References:
References
UniProtQ9H228 | Q6NW11
EMBLAF331840 | AK074661 | AF317676 | AY262689 | AB083602 | AC011461 | BC034703 | BC067781
InterProIPR000276 | IPR005386 | IPR017452 | IPR004061
PRODOM
GENEID53637
MIM605146
PRINTSPR01561 | PR00237 | PR01523
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameLYSOPHOSPHOLIPID RECEPTORS_S1P5_Homo sapiens
DescriptionRecName: Full=Sphingosine 1-phosphate receptor 5; Short=S1P receptor 5; Short=S1P5;AltName: Full=Sphingosine 1-phosphate receptor Edg-8; Short=S1P receptor Edg-8;AltName: Full=Endothelial differentiation G-protein-coupled receptor 8
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneS1PR5 | EDG
FunctionReceptor for the lysosphingolipid sphingosine 1-s phosphate (S1P)
Fragment0
Sequence
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-13_Homo sapiensG12/1310799507
2Galpha-z_Homo sapiensGi/o10799507
3Galpha-i3_Homo sapiensGi/o10799507
4Galpha-o_Homo sapiensGi/o10799507
5Galpha-i2_Homo sapiensGi/o10799507
6Galpha-i1_Homo sapiensGi/o10799507
7Galpha-12_Homo sapiensG12/1310799507
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level