Quick search:







Description Entry page for GPCR - 'MELANIN-CONCENTRATING RECEPTORS_MCH2_Homo sapiens'
ClassCLASS A
FamilyMELANIN-CONCENTRATING RECEPTORS
Sub-FamilyMCH2
Cross References:
References
UniProtQ969V1 | B3KVW4 | Q5VTV7 | Q6Q377 | Q9BXA8
EMBLAB060151 | AY029596 | AF399937 | AF347063 | AB058849 | AY562946 | AK123634 | AL590725 | BC095515
InterProIPR000276 | IPR017452 | IPR008362 | IPR008361
PRODOM
GENEID84539
MIM606111
PRINTSPR00237 | PR01784 | PR01783
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMELANIN-CONCENTRATING RECEPTORS_MCH2_Homo sapiens
DescriptionRecName: Full=Melanin-concentrating hormone receptor 2; Short=MCH receptor 2; Short=MCHR-2; Short=MCH-R2;AltName: Full=MCH-2R; Short=MCH2R; Short=MCH2;AltName: Full=G-protein coupled receptor 145;AltName: Full=GPRv17
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneMCHR2 | GPR145,SL
FunctionReceptor for melanin-concentrating hormone, coupled to Gs proteins that activate phosphoinositide hydrolysis
Fragment0
Sequence
MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII
RSRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC
SAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDG
VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS
VPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS
INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o11274220 | 11355873 | 11562423
2Galpha-i1_Homo sapiensGi/o11274220 | 11355873 | 11562423
3Galpha-i3_Homo sapiensGi/o11274220 | 11355873 | 11562423
4Galpha-z_Homo sapiensGi/o11274220 | 11355873 | 11562423
5Galpha-o_Homo sapiensGi/o11274220 | 11355873 | 11562423
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level