Quick search:







Description Entry page for GPCR - 'MELANOCORTIN RECEPTORS_MC2_Homo sapiens'
ClassCLASS A
FamilyMELANOCORTIN RECEPTORS
Sub-FamilyMC2
Cross References:
References
UniProtQ01718 | Q3MI45 | Q504X6
EMBLX65633 | AB065915 | BC069074 | BC094710 | BC104169 | BC104170 | AY225229
InterProIPR000276 | IPR001168 | IPR017452 | IPR001671
PRODOM
GENEID4158
MIM202200 | 607397
PRINTSPR00520 | PR00237 | PR00534
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMELANOCORTIN RECEPTORS_MC2_Homo sapiens
DescriptionRecName: Full=Adrenocorticotropic hormone receptor; Short=ACTH receptor; Short=ACTH-R; Short=Adrenocorticotropin receptor;AltName: Full=Melanocortin receptor 2;AltName: Full=MC2-R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneMC2R | ACTH
FunctionReceptor for ACTH
Fragment0
Sequence
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMY
FFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFS
LSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTS
LFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVL
LMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs1325670
2Galpha-s_Homo sapiens_2Gs1325670
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level