Quick search:







Description Entry page for GPCR - 'MELANOCORTIN RECEPTORS_MC3_Homo sapiens'
ClassCLASS A
FamilyMELANOCORTIN RECEPTORS
Sub-FamilyMC3
Cross References:
References
UniProtP41968 | Q4KN27 | Q9H517
EMBLL06155 | AY227893 | AL139824 | BC069105 | BC069599 | BC096702 | BC096737 | BC098169 | BC098351
InterProIPR000276 | IPR017452 | IPR002122 | IPR001908 | IPR001671
PRODOM
GENEID4159
MIM155540 | 602025
PRINTSPR00237 | PR00534 | PR00535 | PR01061
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMELANOCORTIN RECEPTORS_MC3_Homo sapiens
DescriptionRecName: Full=Melanocortin receptor 3;AltName: Full=MC3-R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneMC3
FunctionReceptor for MSH (alpha, beta and gamma) and ACTH
Fragment0
Sequence
MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPTLPNGSEHLQA
PFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVA
DMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRY
VTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLM
GTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLV
LIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs8463333
2Galpha-s_Homo sapiens_2Gs8463333
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level