Quick search:







Description Entry page for GPCR - 'MELANOCORTIN RECEPTORS_MC5_Homo sapiens'
ClassCLASS A
FamilyMELANOCORTIN RECEPTORS
Sub-FamilyMC5
Cross References:
References
UniProtP33032 | Q502V1
EMBLZ25470 | L27080 | U08353 | AY268429 | BC069153 | BC069545 | BC095531
InterProIPR000276 | IPR017452 | IPR001908 | IPR000621 | IPR001671
PRODOM
GENEID4161
MIM600042
PRINTSPR00237 | PR00534 | PR00535 | PR01063
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMELANOCORTIN RECEPTORS_MC5_Homo sapiens
DescriptionRecName: Full=Melanocortin receptor 5;AltName: Full=MC5-R;AltName: Full=MC-2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneMC5
FunctionReceptor for MSH (alpha, beta and gamma) and ACTH
Fragment0
Sequence
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs8185570
2Galpha-s_Homo sapiens_2Gs8185570
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level