Quick search:







Description Entry page for GPCR - 'MELATONIN RECEPTORS_MT2_Homo sapiens'
ClassCLASS A
FamilyMELATONIN RECEPTORS
Sub-FamilyMT2
Cross References:
References
UniProtP49286
EMBLU25341 | AB033598 | AY521019 | BC069163
InterProIPR000276 | IPR017452 | IPR002278 | IPR000025
PRODOM
GENEID4544
MIM600804
PRINTSPR00237 | PR01149 | PR00857
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMELATONIN RECEPTORS_MT2_Homo sapiens
DescriptionRecName: Full=Melatonin receptor type 1B;AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneMTNR1
FunctionHigh affinity receptor for melatonin
Fragment0
Sequence
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o7946354
2Galpha-i1_Homo sapiensGi/o7946354
3Galpha-i2_Homo sapiensGi/o7946354
4Galpha-i3_Homo sapiensGi/o7946354
5Galpha-o_Homo sapiensGi/o7946354
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level