Quick search:







Description Entry page for GPCR - 'MOTILIN RECEPTORS_Motilin_Homo sapiens'
ClassCLASS A
FamilyMOTILIN RECEPTORS
Sub-FamilyMotilin
Cross References:
References
UniProtO43193
EMBLAF034632 | AY603964 | AL137000
InterProIPR000276 | IPR003905 | IPR017452
PRODOM
GENEID2862
MIM602885
PRINTSPR01417 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMOTILIN RECEPTORS_Motilin_Homo sapiens
DescriptionRecName: Full=Motilin receptor;AltName: Full=G-protein coupled receptor 38
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneMLNR | GPR38,MTLR,MTLR
FunctionReceptor for motilin
Fragment0
Sequence
MGSPWNGSDGPEGAREPPWPALPPCDERRCSPFPLGALVPVTAVCLCLFVVGVSGNVVTV
MLIGRYRDMRTTTNLYLGSMAVSDLLILLGLPFDLYRLWRSRPWVFGPLLCRLSLYVGEG
CTYATLLHMTALSVERYLAICRPLRARVLVTRRRVRALIAVLWAVALLSAGPFLFLVGVE
QDPGISVVPGLNGTARIASSPLASSPPLWLSRAPPPSPPSGPETAEAAALFSRECRPSPA
QLGALRVMLWVTTAYFFLPFLCLSILYGLIGRELWSSRRPLRGPAASGRERGHRQTVRVL
LVVVLAFIICWLPFHVGRIIYINTEDSRMMYFSQYFNIVALQLFYLSASINPILYNLISK
KYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGDTVGYTETSANVKTMG
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-14_Homo sapiensGq/1118032475
2Galpha-11_Homo sapiensGq/1118032475
3Galpha-q_Homo sapiensGq/1118032475
4Galpha-13_Homo sapiensG12/1318032475
5Galpha-15_Homo sapiensGq/1118032475
6Galpha-12_Homo sapiensG12/1318032475
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level