Quick search:







Description Entry page for GPCR - 'MUSCARINIC ACETYLCHOLINE RECEPTORS_M1_Homo sapiens'
ClassCLASS A
FamilyMUSCARINIC ACETYLCHOLINE RECEPTORS
Sub-FamilyM1
Cross References:
References
UniProtP11229
EMBLY00508 | X52068 | X15263 | AF498915 | BC007740 | BC022984
InterProIPR000276 | IPR017452 | IPR002228 | IPR000995
PRODOM
GENEID1128
MIM118510
PRINTSPR00237 | PR00243 | PR00538
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMUSCARINIC ACETYLCHOLINE RECEPTORS_M1_Homo sapiens
DescriptionRecName: Full=Muscarinic acetylcholine receptor M1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCHRM
FunctionThe muscarinic acetylcholine receptor mediates variouss cellular responses, including inhibition of adenylate cyclase,s breakdown of phosphoinositides and modulation of potassiums channels through the action of G proteins
Fragment0
Sequence
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-14_Homo sapiensGq/113037705
2Galpha-11_Homo sapiensGq/113037705
3Galpha-12_Homo sapiensG12/133037705
4Galpha-15_Homo sapiensGq/113037705
5Galpha-13_Homo sapiensG12/133037705
6Galpha-q_Homo sapiensGq/113037705
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level