Quick search:







Description Entry page for GPCR - 'MUSCARINIC ACETYLCHOLINE RECEPTORS_M2_Homo sapiens'
ClassCLASS A
FamilyMUSCARINIC ACETYLCHOLINE RECEPTORS
Sub-FamilyM2
Cross References:
References
UniProtP08172 | Q4VBK6 | Q9P1X9
EMBLM16404 | X15264 | AF498916 | BC095547 | BC106741 | BC106742 | AB041391
InterProIPR000276 | IPR017452 | IPR001065 | IPR000995
PRODOM
GENEID1129
MIM103780 | 118493 | 608516
PRINTSPR00237 | PR00243 | PR00539
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMUSCARINIC ACETYLCHOLINE RECEPTORS_M2_Homo sapiens
DescriptionRecName: Full=Muscarinic acetylcholine receptor M2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCHRM
FunctionThe muscarinic acetylcholine receptor mediates variouss cellular responses, including inhibition of adenylate cyclase,s breakdown of phosphoinositides and modulation of potassiums channels through the action of G proteins
Fragment0
Sequence
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o3443095
2Galpha-i3_Homo sapiensGi/o3443095
3Galpha-o_Homo sapiensGi/o3443095
4Galpha-i1_Homo sapiensGi/o3443095
5Galpha-z_Homo sapiensGi/o3443095
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level