Quick search:







Description Entry page for GPCR - 'MUSCARINIC ACETYLCHOLINE RECEPTORS_M3_Homo sapiens'
ClassCLASS A
FamilyMUSCARINIC ACETYLCHOLINE RECEPTORS
Sub-FamilyM3
Cross References:
References
UniProtP20309 | Q0VAJ8 | Q4QRI3 | Q5VXY2 | Q9HB60
EMBLX15266 | U29589 | AB041395 | AF498917 | AL356361 | BC096844 | BC121026 | AF279779
InterProIPR000276 | IPR017452 | IPR001183 | IPR000995
PRODOM
GENEID1131
MIM118494
PRINTSPR00237 | PR00243 | PR00540
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMUSCARINIC ACETYLCHOLINE RECEPTORS_M3_Homo sapiens
DescriptionRecName: Full=Muscarinic acetylcholine receptor M3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCHRM
FunctionThe muscarinic acetylcholine receptor mediates variouss cellular responses, including inhibition of adenylate cyclase,s breakdown of phosphoinositides and modulation of potassiums channels through the action of G proteins
Fragment0
Sequence
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/1111242080
2Galpha-12_Homo sapiensG12/1311242080
3Galpha-q_Homo sapiensGq/1111242080
4Galpha-13_Homo sapiensG12/1311242080
5Galpha-14_Homo sapiensGq/1111242080
6Galpha-11_Homo sapiensGq/1111242080
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level