Quick search:







Description Entry page for GPCR - 'MUSCARINIC ACETYLCHOLINE RECEPTORS_M4_Homo sapiens'
ClassCLASS A
FamilyMUSCARINIC ACETYLCHOLINE RECEPTORS
Sub-FamilyM4
Cross References:
References
UniProtP08173 | Q0VD60 | Q4VBK7
EMBLM16405 | X15265 | AF498918 | BC095546 | BC119775 | BC119817
InterProIPR000276 | IPR017452 | IPR001432 | IPR000995
PRODOM
GENEID1132
MIM118495
PRINTSPR00237 | PR00243 | PR00541
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMUSCARINIC ACETYLCHOLINE RECEPTORS_M4_Homo sapiens
DescriptionRecName: Full=Muscarinic acetylcholine receptor M4
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCHRM
FunctionThe muscarinic acetylcholine receptor mediates variouss cellular responses, including inhibition of adenylate cyclase,s breakdown of phosphoinositides and modulation of potassiums channels through the action of G proteins
Fragment0
Sequence
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o3037705
2Galpha-i3_Homo sapiensGi/o3037705
3Galpha-i1_Homo sapiensGi/o3037705
4Galpha-o_Homo sapiensGi/o3037705
5Galpha-i2_Homo sapiensGi/o3037705
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level