Quick search:







Description Entry page for GPCR - 'NEUROMEDIN U RECEPTORS_NMU1_Homo sapiens'
ClassCLASS A
FamilyNEUROMEDIN U RECEPTORS
Sub-FamilyNMU1
Cross References:
References
UniProtQ9HB89 | O43664 | Q7LDP6 | Q8NE20
EMBLAF272362 | AC017104 | BC036543 | BC051914 | AF044601 | AF044600
InterProIPR000276 | IPR017452 | IPR005390 | IPR005391
PRODOM
GENEID10316
MIM604153
PRINTSPR00237 | PR01565 | PR01566
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROMEDIN U RECEPTORS_NMU1_Homo sapiens
DescriptionRecName: Full=Neuromedin-U receptor 1; Short=NMU-R1;AltName: Full=G-protein coupled receptor 66;AltName: Full=G-protein coupled receptor FM-3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNMUR1 | GPR6
FunctionReceptor for the neuromedin-U and neuromedin-Ss neuropeptides (By similarity)
Fragment0
Sequence
MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELF
MPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYE
MWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRR
VLGAVWGLAMLCSLPNTSLHGIRQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFF
CLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLF
VLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMS
SRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQ
QETDPS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o10894543
2Galpha-11_Homo sapiensGq/1110894543
3Galpha-q_Homo sapiensGq/1110894543
4Galpha-14_Homo sapiensGq/1110894543
5Galpha-15_Homo sapiensGq/1110894543
6Galpha-z_Homo sapiensGi/o10894543
7Galpha-i2_Homo sapiensGi/o10894543
8Galpha-i3_Homo sapiensGi/o10894543
9Galpha-o_Homo sapiensGi/o10894543
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level