Quick search:







Description Entry page for GPCR - 'NEUROPEPTIDE FF/AF RECEPTORS_NPFF1_Homo sapiens'
ClassCLASS A
FamilyNEUROPEPTIDE FF/AF RECEPTORS
Sub-FamilyNPFF1
Cross References:
References
UniProtQ9GZQ6 | Q8NGR0 | Q96RN3
EMBLAF268898 | AB040104 | AF330055 | AB065729
InterProIPR000276 | IPR017452 | IPR005395 | IPR005396
PRODOM
GENEID64106
MIM607448
PRINTSPR00237 | PR01570 | PR01571
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROPEPTIDE FF/AF RECEPTORS_NPFF1_Homo sapiens
DescriptionRecName: Full=Neuropeptide FF receptor 1;AltName: Full=G-protein coupled receptor 147;AltName: Full=RFamide-related peptide receptor OT7T022
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNPFFR1 | GPR147,NPFF
FunctionReceptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide)s neuropeptides, also known as morphine-modulating peptides
Fragment0
Sequence
MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVG
NTLVCFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSG
LVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTL
TVTREEHHFMVDARNRSYPLYSCWEAWPEKGMRRVYTTVLFSHIYLAPLALIVVMYARIA
RKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFTLSWLPLWALLLLIDYGQLSA
PQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCPRPSGSHKEAY
SERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH
LPLTIPAWDI
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o15608144
2Galpha-s_Homo sapiens_1Gs15608144
3Galpha-s_Homo sapiens_2Gs15608144
4Galpha-i3_Homo sapiensGi/o15608144
5Galpha-i2_Homo sapiensGi/o15608144
6Galpha-i1_Homo sapiensGi/o15608144
7Galpha-z_Homo sapiensGi/o15608144
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level