Quick search:







Description Entry page for GPCR - 'NEUROPEPTIDE FF/AF RECEPTORS_NPFF2_Homo sapiens'
ClassCLASS A
FamilyNEUROPEPTIDE FF/AF RECEPTORS
Sub-FamilyNPFF2
Cross References:
References
UniProtQ9Y5X5 | Q96RV1 | Q9NR49
EMBLAF119815 | AF257210 | AF268899 | AF236083 | AF330053 | AJ311393
InterProIPR000276 | IPR017452 | IPR005395 | IPR005397
PRODOM
GENEID10886
MIM607449
PRINTSPR00237 | PR01570 | PR01572
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROPEPTIDE FF/AF RECEPTORS_NPFF2_Homo sapiens
DescriptionRecName: Full=Neuropeptide FF receptor 2;AltName: Full=Neuropeptide G-protein coupled receptor;AltName: Full=G-protein coupled receptor 74;AltName: Full=G-protein coupled receptor HLWAR77
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNPFFR2 | GPR74,NPFF2,NPGP
FunctionReceptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide)s neuropeptides, also known as morphine-modulating peptides
Fragment0
Sequence
MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR
LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN
VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT
VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA
IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN
KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN
QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA
HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ
LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o15608144
2Galpha-o_Homo sapiensGi/o15608144
3Galpha-z_Homo sapiensGi/o15608144
4Galpha-i2_Homo sapiensGi/o15608144
5Galpha-s_Homo sapiens_1Gs15608144
6Galpha-i3_Homo sapiensGi/o15608144
7Galpha-s_Homo sapiens_2Gs15608144
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level