Quick search:







Description Entry page for GPCR - 'NEUROPEPTIDE Y RECEPTORS_Y1_Homo sapiens'
ClassCLASS A
FamilyNEUROPEPTIDE Y RECEPTORS
Sub-FamilyY1
Cross References:
References
UniProtP25929 | B2R6H5
EMBLM88461 | M84755 | L07614 | L07615 | AY548168 | AK312578 | CH471056 | BC036657 | BC071720
InterProIPR000276 | IPR017452 | IPR000351 | IPR000611
PRODOM
GENEID4886
MIM162641
PRINTSPR00237 | PR01013 | PR01012
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROPEPTIDE Y RECEPTORS_Y1_Homo sapiens
DescriptionRecName: Full=Neuropeptide Y receptor type 1;AltName: Full=NPY1-R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNPY1R | NPYR,NPYY
FunctionReceptor for neuropeptide Y and peptide YY
Fragment0
Sequence
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o1321422
2Galpha-q_Homo sapiensGq/111321422
3Galpha-o_Homo sapiensGi/o1321422
4Galpha-11_Homo sapiensGq/111321422
5Galpha-14_Homo sapiensGq/111321422
6Galpha-i1_Homo sapiensGi/o1321422
7Galpha-15_Homo sapiensGq/111321422
8Galpha-i2_Homo sapiensGi/o1321422
9Galpha-i3_Homo sapiensGi/o1321422
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level