Quick search:







Description Entry page for GPCR - 'NEUROPEPTIDE Y RECEPTORS_Y2_Homo sapiens'
ClassCLASS A
FamilyNEUROPEPTIDE Y RECEPTORS
Sub-FamilyY2
Cross References:
References
UniProtP49146 | Q13281 | Q13457 | Q6AZZ6 | Q9UE67
EMBLU36269 | U42766 | U32500 | U42389 | U50146 | U76254 | AY236540 | BC075053 | BC075052
InterProIPR000276 | IPR017452 | IPR001358 | IPR000611
PRODOM
GENEID4887
MIM162642
PRINTSPR00237 | PR01014 | PR01012
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROPEPTIDE Y RECEPTORS_Y2_Homo sapiens
DescriptionRecName: Full=Neuropeptide Y receptor type 2; Short=NPY2-R;AltName: Full=NPY-Y2 receptor; Short=Y2 receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNPY2
FunctionReceptor for neuropeptide Y and peptide YY
Fragment0
Sequence
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o7559383
2Galpha-z_Homo sapiensGi/o7559383
3Galpha-i1_Homo sapiensGi/o7559383
4Galpha-i3_Homo sapiensGi/o7559383
5Galpha-i2_Homo sapiensGi/o7559383
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level