Quick search:







Description Entry page for GPCR - 'NEUROPEPTIDE Y RECEPTORS_Y4_Homo sapiens'
ClassCLASS A
FamilyNEUROPEPTIDE Y RECEPTORS
Sub-FamilyY4
Cross References:
References
UniProtP50391 | Q13456 | Q5ISU3 | Q6FH06
EMBLU35232 | Z66526 | U42387 | AY649985 | AY268432 | CR541950 | BC096238
InterProIPR000276 | IPR017452 | IPR001933 | IPR000611
PRODOM
GENEID5540
MIM601790
PRINTSPR00237 | PR01015 | PR01012
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROPEPTIDE Y RECEPTORS_Y4_Homo sapiens
DescriptionRecName: Full=Neuropeptide Y receptor type 4; Short=NPY4-R;AltName: Full=Pancreatic polypeptide receptor 1; Short=PP1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePPYR1 | NPY4
FunctionReceptor for neuropeptide Y and peptide YY
Fragment0
Sequence
MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL
CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI
QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL
ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRR
LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG
NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE
VSKGSLRLSGRSNPI
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o7592911
2Galpha-o_Homo sapiensGi/o7592911
3Galpha-z_Homo sapiensGi/o7592911
4Galpha-i1_Homo sapiensGi/o7592911
5Galpha-i2_Homo sapiensGi/o7592911
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level