Quick search:







Description Entry page for GPCR - 'NEUROPEPTIDE Y RECEPTORS_Y5_Homo sapiens'
ClassCLASS A
FamilyNEUROPEPTIDE Y RECEPTORS
Sub-FamilyY5
Cross References:
References
UniProtQ15761 | Q6GTR7 | Q92916
EMBLU66275 | U56079 | U94320 | AY322538 | AL135818 | CH471056 | BC042416
InterProIPR000276 | IPR017452 | IPR000393 | IPR000611
PRODOM
GENEID4889
MIM602001
PRINTSPR00237 | PR01016 | PR01012
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROPEPTIDE Y RECEPTORS_Y5_Homo sapiens
DescriptionRecName: Full=Neuropeptide Y receptor type 5; Short=NPY5-R;AltName: Full=NPY-Y5 receptor; Short=Y5 receptor;AltName: Full=NPYY5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNPY5R | NPYR
FunctionReceptor for neuropeptide Y and peptide YY
Fragment0
Sequence
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-14_Homo sapiensGq/118700207
2Galpha-11_Homo sapiensGq/118700207
3Galpha-15_Homo sapiensGq/118700207
4Galpha-q_Homo sapiensGq/118700207
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level