Quick search:







Description Entry page for GPCR - 'NEUROPEPTIDE Y RECEPTORS_Y6_Homo sapiens'
ClassCLASS A
FamilyNEUROPEPTIDE Y RECEPTORS
Sub-FamilyY6
Cross References:
References
UniProtQ99463
EMBLD86519 | U59431 | U67780 | CH471062
InterProIPR000276 | IPR017452 | IPR000986 | IPR000611
PRODOM
GENEID
MIM601770
PRINTSPR00237 | PR01017 | PR01012
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROPEPTIDE Y RECEPTORS_Y6_Homo sapiens
DescriptionRecName: Full=Putative neuropeptide Y receptor type 6; Short=NPY6-R;AltName: Full=NPY Y1-like receptor;AltName: Full=Putative pancreatic polypeptide receptor 2; Short=PP2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNPY6R | NPY1RL,Y2
FunctionWhen expressed, is unable to bind pancreatic polypeptides (PP), neuropeptide Y (NPY), or peptide YY (PYY), suggesting thats either it is functionally inactive or that it may have acquired as pancreatic polypeptide-independent function
Fragment0
Sequence
MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIII
FKKQRKAQNFTSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSI
SVSIFSLVFTAVERYQLIVNPRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPF
RNLSLPTDLYTHQVACVENWPSKKDRLLFTTSLFLLQYFVPLGFILICYLKIVICLRRRN
AKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISSMSSLTGIMRC
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-11_Homo sapiensGq/118700207
2Galpha-14_Homo sapiensGq/118700207
3Galpha-15_Homo sapiensGq/118700207
4Galpha-q_Homo sapiensGq/118700207
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level