Quick search:







Description Entry page for GPCR - 'NEUROTENSIN RECEPTORS_NTS2_Homo sapiens'
ClassCLASS A
FamilyNEUROTENSIN RECEPTORS
Sub-FamilyNTS2
Cross References:
References
UniProtO95665 | Q8IY58 | Q8TBH6
EMBLY10148 | AY429107 | BC022501 | BC037776
InterProIPR000276 | IPR017452 | IPR003986 | IPR003984
PRODOM
GENEID23620
MIM605538
PRINTSPR00237 | PR01479 | PR01481
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNEUROTENSIN RECEPTORS_NTS2_Homo sapiens
DescriptionRecName: Full=Neurotensin receptor type 2;AltName: Full=NTR2 receptor; Short=NT-R-2;AltName: Full=Levocabastine-sensitive neurotensin receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNTSR
FunctionReceptor for the tridecapeptide neurotensin
Fragment0
Sequence
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSVHVVLKA
RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY
ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL
ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV
PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR
AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA
VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-q_Homo sapiensGq/118647296
2Galpha-15_Homo sapiensGq/118647296
3Galpha-14_Homo sapiensGq/118647296
4Galpha-11_Homo sapiensGq/118647296
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level