Quick search:







Description Entry page for GPCR - 'NICOTINIC ACID RECEPTORS_NIACR2_Homo sapiens'
ClassCLASS A
FamilyNICOTINIC ACID RECEPTORS
Sub-FamilyNIACR2
Cross References:
References
UniProtP49019 | A8K4G5 | B2R830 | Q8NGE4
EMBLD10923 | AB065865 | AK290930 | AK313212 | EU293604 | BC047891
InterProIPR000276 | IPR017452 | IPR002286
PRODOM
GENEID8843
MIM606039
PRINTSPR00237 | PR01157
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNICOTINIC ACID RECEPTORS_NIACR2_Homo sapiens
DescriptionRecName: Full=G-protein coupled receptor 109B;AltName: Full=Niacin receptor 2;AltName: Full=Nicotinic acid receptor 2;AltName: Full=G-protein coupled receptor HM74B;AltName: Full=G-protein coupled receptor HM74
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNIACR2 | GPR109
FunctionReceptor for 3-OH-octanoid acid mediates a negatives feedback regulation of adipocyte lipolysis to counteracts prolipolytic influences under conditions of physiological ors pathological increases in beta-oxidation rates
Fragment0
Sequence
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWK
SSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTV
VAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGPANVCISF
SICHTFRWHEAMFLLEFLLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVF
VICFLPSVVVRIRIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPS
FPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
TSNNHSKKGHCHQEPASLEKQLGCCIE
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o15183629 | 12563315
2Galpha-i2_Homo sapiensGi/o15183629 | 12563315
3Galpha-i1_Homo sapiensGi/o15183629 | 12563315
4Galpha-o_Homo sapiensGi/o15183629 | 12563315
5Galpha-i3_Homo sapiensGi/o15183629 | 12563315
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level