Quick search:







Description Entry page for GPCR - 'NICOTINIC ACID RECEPTORS_Nicotinic acid receptor_Homo sapiens'
ClassCLASS A
FamilyNICOTINIC ACID RECEPTORS
Sub-FamilyNicotinic acid receptor
Cross References:
References
UniProtQ9BXC0 | B2R9X4 | Q3Y5J3 | Q4VBN1 | Q6NXU5
EMBLAF411110 | EU809458 | AF345568 | AB065866 | AY507143 | AK313955 | AB083631 | DQ157221 | AC026333 | CH471054 | BC066881 | BC066882 | BC066883 | BC067484 | BC095506
InterProIPR000276 | IPR017452
PRODOM
GENEID27198
MIM606923
PRINTSPR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameNICOTINIC ACID RECEPTORS_Nicotinic acid receptor_Homo sapiens
DescriptionRecName: Full=G-protein coupled receptor 81;AltName: Full=G-protein coupled receptor 104
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPR81 | GPR104 | FKSG8
FunctionActs as a receptor for L-lactate and mediates its anti-s lipolytic effect through a G(i)-protein-mediated pathway
Fragment0
Sequence
MYNGSCCRIEGDTISQVMPPLLIVAFVLGALGNGVALCGFCFHMKTWKPSTVYLFNLAVA
DFLLMICLPFRTDYYLRRRHWAFGDIPCRVGLFTLAMNRAGSIVFLTVVAADRYFKVVHP
HHAVNTISTRVAAGIVCTLWALVILGTVYLLLENHLCVQETAVSCESFIMESANGWHDIM
FQLEFFMPLGIILFCSFKIVWSLRRRQQLARQARMKKATRFIMVVAIVFITCYLPSVSAR
LYFLWTVPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPK
QPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o15183629 | 12563315
2Galpha-o_Homo sapiensGi/o15183629 | 12563315
3Galpha-i1_Homo sapiensGi/o15183629 | 12563315
4Galpha-z_Homo sapiensGi/o15183629 | 12563315
5Galpha-i3_Homo sapiensGi/o15183629 | 12563315
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level