Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-1A_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-1A
Cross References:
References
UniProtP08908 | Q6LAE7
EMBLM28269 | X13556 | X57829 | M83181 | AB041403 | AF498978 | BC069159 | Z11168
InterProIPR000610 | IPR002231 | IPR000276 | IPR017452
PRODOM
GENEID3350
MIM109760
PRINTSPR00512 | PR01101 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-1A_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 1A; Short=5-HT-1A; Short=5-HT1A;AltName: Full=Serotonin receptor 1A;AltName: Full=G-21
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR1A | ADRB2RL1,ADRBRL
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
2Galpha-i3_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
3Galpha-i2_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
4Galpha-z_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
5Galpha-o_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level