Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR10_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR10
Cross References:
References
UniProtO00590 | B2R8Y8 | O00537 | Q53YA1 | Q86UN9 | Q96A02
EMBLU94888 | Y12815 | AY262687 | BT006800 | AK313561 | BC008816 | BC011631 | BC020558 | BC101629 | BC112045
InterProIPR000276 | IPR000355 | IPR001277 | IPR017452
PRODOM
GENEID1238
MIM602648
PRINTSPR00657 | PR00645 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR10_Homo sapiens
DescriptionRecName: Full=Chemokine-binding protein 2;AltName: Full=Chemokine-binding protein D6;AltName: Full=C-C chemokine receptor D6;AltName: Full=Chemokine receptor CCR-9;AltName: Full=Chemokine receptor CCR-10
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCBP2 | CCR10,CMKBR
FunctionReceptor for C-C type chemokines including SCYA2/MCP-1,s SCY3/MIP-1-alpha, SCYA5/RANTES and SCYA7/MCP-3
Fragment0
Sequence
MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLG
LSGNLLLLMVLLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMV
STLYTINFYSGIFFISCMSLDKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDM
VFVQTHENPKGVWNCHADFGGHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSRIGCVLVRL
RPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQVFGNCEVSQHLDYALQVTESI
AFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMT
GMNDLGERQSENYPNKEDVGNKSA
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o10781587
2Galpha-z_Homo sapiensGi/o10781587
3Galpha-i2_Homo sapiensGi/o10781587
4Galpha-o_Homo sapiensGi/o10781587
5Galpha-i1_Homo sapiensGi/o10781587
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level