Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR10_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR10
Cross References:
References
UniProtP46092 | Q4V749 | Q6T7X2 | Q9NZG2
EMBLAF215981 | AF208237 | AY429103 | BC098132 | BC098157 | BC098304 | BC099840 | U13667
InterProIPR000276 | IPR005382 | IPR000355 | IPR017452
PRODOM
GENEID2826
MIM600240
PRINTSPR00657 | PR01557 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR10_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 10; Short=C-C CKR-10; Short=CC-CKR-10; Short=CCR-10;AltName: Full=G-protein coupled receptor 2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR10 | GPR
FunctionReceptor for chemokines SCYA27 and SCYA28
Fragment0
Sequence
MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNG
LVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLY
SASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFS
QDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGP
ERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL
ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSW
DN
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o10781587
2Galpha-i2_Homo sapiensGi/o10781587
3Galpha-i3_Homo sapiensGi/o10781587
4Galpha-i1_Homo sapiensGi/o10781587
5Galpha-z_Homo sapiensGi/o10781587
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level