Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR1_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR1
Cross References:
References
UniProtP32246 | Q86VA9
EMBLL09230 | L10918 | D10925 | BC051306 | BC064991
InterProIPR000276 | IPR002236 | IPR000355 | IPR017452
PRODOM
GENEID1230
MIM601159
PRINTSPR00657 | PR01106 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR1_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 1; Short=C-C CKR-1; Short=CC-CKR-1; Short=CCR-1; Short=CCR1;AltName: Full=Macrophage inflammatory protein 1-alpha receptor; Short=MIP-1alpha-R;AltName: Full=RANTES-R;AltName: Full=HM145;AltName: Full=LD78 receptor;AltName: CD_antigen=CD191
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR1 | CMKBR1,CMKR1,SCYAR
FunctionReceptor for a C-C type chemokine
Fragment0
Sequence
METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o7679328
2Galpha-z_Homo sapiensGi/o7679328
3Galpha-i3_Homo sapiensGi/o7679328
4Galpha-o_Homo sapiensGi/o7679328
5Galpha-i1_Homo sapiensGi/o7679328
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level