Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR2_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR2
Cross References:
References
UniProtP41597 | A0AVQ3 | B2RMT0
EMBLU03882 | U03905 | D29984 | U80924 | U80924 | AF545480 | U95626 | U95626 | BC074751 | BC126452 | BC136396
InterProIPR000276 | IPR002237 | IPR002240 | IPR000355 | IPR017452
PRODOM
GENEID729230
MIM601267 | 609423
PRINTSPR00657 | PR01107 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR2_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 2; Short=C-C CKR-2; Short=CC-CKR-2; Short=CCR-2; Short=CCR2;AltName: Full=Monocyte chemoattractant protein 1 receptor; Short=MCP-1-R;AltName: CD_antigen=CD192
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR2 | CMKBR
FunctionReceptor for the MCP-1, MCP-3 and MCP-4 chemokines
Fragment0
Sequence
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o8530354
2Galpha-i1_Homo sapiensGi/o8530354
3Galpha-i2_Homo sapiensGi/o8530354
4Galpha-z_Homo sapiensGi/o8530354
5Galpha-o_Homo sapiensGi/o8530354
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level