Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR3_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR3
Cross References:
References
UniProtP51677 | Q15748 | Q2YDB9 | Q86WD2 | Q9ULY8
EMBLU28694 | U51241 | U49727 | AF026535 | AB023887 | AF247361 | AY221092 | EF064760 | BC110297 | BC130318 | BC130320
InterProIPR000276 | IPR002238 | IPR000355 | IPR017452
PRODOM
GENEID1232
MIM601268
PRINTSPR00657 | PR01108 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR3_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 3; Short=C-C CKR-3; Short=CC-CKR-3; Short=CCR-3; Short=CCR3; Short=CKR3;AltName: Full=Eosinophil eotaxin receptor;AltName: CD_antigen=CD193
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR3 | CMKBR
FunctionReceptor for a C-C type chemokine
Fragment0
Sequence
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o8631813
2Galpha-i2_Homo sapiensGi/o8631813
3Galpha-o_Homo sapiensGi/o8631813
4Galpha-i1_Homo sapiensGi/o8631813
5Galpha-i3_Homo sapiensGi/o8631813
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level