Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR4_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR4
Cross References:
References
UniProtP51679 | Q9ULY6 | Q9ULY7
EMBLX85740 | AB023888 | AB023889 | AB023890 | AB023891 | AB023892 | AY322539 | BC069139 | BC071751 | BC074935
InterProIPR000276 | IPR002239 | IPR000355 | IPR017452
PRODOM
GENEID1233
MIM604836
PRINTSPR00657 | PR01109 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR4_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 4; Short=C-C CKR-4; Short=CC-CKR-4; Short=CCR-4; Short=CCR4;AltName: Full=K5-5;AltName: CD_antigen=CD194
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR4 | CMKBR
FunctionHigh affinity receptor for the C-C type chemokiness CCL17/TARC and CCL22/MDC
Fragment0
Sequence
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVG
FYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o9169480
2Galpha-o_Homo sapiensGi/o9169480
3Galpha-i3_Homo sapiensGi/o9169480
4Galpha-i1_Homo sapiensGi/o9169480
5Galpha-z_Homo sapiensGi/o9169480
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level