Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR5_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR5
Cross References:
References
UniProtP51681 | O14692 | O14693 | O14695 | O14696 | O14697 | O14698 | O14699
EMBLX91492 | U54994 | U57840 | U83326 | AF011500 | AF011501 | AF011502 | AF011503 | AF011505 | AF011506 | AF011507 | AF011508 | AF011509 | AF011510 | AF011511 | AF011512 | AF011513 | AF011514 | AF011515 | AF011516 | AF011517 | AF011518 | AF011519 | AF011520 | AF011521 | AF011522 | AF011523 | AF011524 | AF011525 | AF011526 | AF011527 | AF011528 | AF011529 | AF011530 | AF011531 | AF011532 | AF011533 | AF011534 | AF011535 | AF011536 | AF011537 | AF031237 | AF052539 | AY221093 | U95626 | BC038398
InterProIPR000276 | IPR002240 | IPR000355 | IPR017452
PRODOM
GENEID1234
MIM601373 | 609423 | 610379 | 612522
PRINTSPR00657 | PR01110 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR5_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Short=CC-CKR-5; Short=CCR-5; Short=CCR5;AltName: Full=HIV-1 fusion coreceptor;AltName: Full=CHEMR13;AltName: CD_antigen=CD195
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR5 | CMKBR
FunctionReceptor for a number of inflammatory CC-chemokiness including MIP-1-alpha, MIP-1-beta and RANTES and subsequentlys transduces a signal by increasing the intracellular calcium ions level
Fragment0
Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o8639485
2Galpha-o_Homo sapiensGi/o8639485
3Galpha-z_Homo sapiensGi/o8639485
4Galpha-i1_Homo sapiensGi/o8639485
5Galpha-i3_Homo sapiensGi/o8639485
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level